Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C8G protein

This Human C8G protein spans the amino acid sequence from region 21-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C8G

UniProt

P07360

Expression Region

21-202aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-202aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human WDR24 Protein, N-His-SUMO
HP377012-01 50 µg

Recombinant Human WDR24 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human WDR24 Protein, N-His-SUMO
HP377012-02 100 µg

Recombinant Human WDR24 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human WDR24 Protein, N-His-SUMO
HP377012-03 1 mg

Recombinant Human WDR24 Protein, N-His-SUMO

Sign In for Pricing
View Details
DSG4 siRNA (Human)
orb1852738-01 15 nmol

DSG4 siRNA (Human)

Sign In for Pricing
View Details
DSG4 siRNA (Human)
orb1852738-02 30 nmol

DSG4 siRNA (Human)

Sign In for Pricing
View Details
MyD88 Antibody
3244R-30T 30 µg

MyD88 Antibody

Sign In for Pricing
View Details