Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C8G protein

This Human C8G protein spans the amino acid sequence from region 21-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C8G

UniProt

P07360

Expression Region

21-202aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-202aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA2 3'UTR GFP Stable Cell Line
TU053323 1.0 mL

CA2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SLC8A2 3'UTR GFP Stable Cell Line
TU073356 1.0 mL

SLC8A2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
4- (2-Aminopropyl) -2-methyl-phenol Hydrobromide
428529-01 1 mg

4- (2-Aminopropyl) -2-methyl-phenol Hydrobromide

Sign In for Pricing
View Details
4- (2-Aminopropyl) -2-methyl-phenol Hydrobromide
428529-02 2.5 mg

4- (2-Aminopropyl) -2-methyl-phenol Hydrobromide

Sign In for Pricing
View Details
REXO4 Protein Vector (Rat) (pPB-C-His)
PV298858 500 ng

REXO4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Syntenin 1 (ST1)
MBS2094918-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Syntenin 1 (ST1)

Sign In for Pricing
View Details