Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMPR1A protein

This Human BMPR1A protein spans the amino acid sequence from region 177-532aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BMPR1A

UniProt

P36894

Expression Region

177-532aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic of His-SUMO-tag and expression region is 177-532aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMI1 Knockout Huh-7 Cell Line
ARG43752 1 Million

BMI1 Knockout Huh-7 Cell Line

Sign In for Pricing
View Details
6-Bromo-2-naphthol, ≥97%
234545-01 25 g

6-Bromo-2-naphthol, ≥97%

Sign In for Pricing
View Details
6-Bromo-2-naphthol, ≥97%
234545-02 100 g

6-Bromo-2-naphthol, ≥97%

Sign In for Pricing
View Details
6-Bromo-2-naphthol, ≥97%
234545-03 250 g

6-Bromo-2-naphthol, ≥97%

Sign In for Pricing
View Details
6-Bromo-2-naphthol, ≥97%
234545-04 1 Kg

6-Bromo-2-naphthol, ≥97%

Sign In for Pricing
View Details
Recombinant Human tPA (C-6His)
PHH1703-01 10 µg

Recombinant Human tPA (C-6His)

Sign In for Pricing
View Details