Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BDNF protein

This Human BDNF protein spans the amino acid sequence from region 129-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Abrineurin protein, BDNF protein, Brain Derived Neurotrophic Factor protein, Brain-derived neurotrophic factor protein, Neurotrophin protein

UniProt

P23560

Expression Region

129-247aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 129-247aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN1 Mouse Monoclonal Antibody [Clone ID: LBI1E1]
AMM14228V 100 µL

SEPTIN1 Mouse Monoclonal Antibody [Clone ID: LBI1E1]

Sign In for Pricing
View Details
Atg14 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4566004 1.0 µg DNA

Atg14 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
6-Aminopyridine-3-boronic acid-HCl
CSB-DT4476 1 g

6-Aminopyridine-3-boronic acid-HCl

Sign In for Pricing
View Details
Rabbit Polyclonal PDK-1 Antibody
NB100-2384 0.1 mL

Rabbit Polyclonal PDK-1 Antibody

Sign In for Pricing
View Details
Eukaryotic aspartyl protease Rabbit pAb
E47R0613 100 µL

Eukaryotic aspartyl protease Rabbit pAb

Sign In for Pricing
View Details
Iso-H7 dihydrochloride
S6510-5mg 5 mg

Iso-H7 dihydrochloride

Sign In for Pricing
View Details