Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse AMH protein

This Mouse AMH protein spans the amino acid sequence from region 450-552aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Muellerian hormone protein, MIS protein, Muellerian inhibiting factor protein, Mullerian inhibiting substance protein, AMH protein

UniProt

P27106

Expression Region

450-552aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 7, CT (H422) (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (Biotin) discontinued
S1013-60D-Biotin 200 µL

Siglec 7, CT (H422) (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (Biotin) discontinued

Sign In for Pricing
View Details
Human LMNB2 (Lamin B2) ELISA Kit
EK244181 96 Well

Human LMNB2 (Lamin B2) ELISA Kit

Sign In for Pricing
View Details
UR-RG98
MBS5784485 Inquire

UR-RG98

Sign In for Pricing
View Details
1-butyl-1H-pyrazol-5-amine
sc-333821A 5 g

1-butyl-1H-pyrazol-5-amine

Sign In for Pricing
View Details
JUND (NM_005354) Human Tagged ORF Clone Lentiviral Particle
RC216958L2V 200 µL

JUND (NM_005354) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-human complement factor H-related 3 polyclonal Antibody
MBS712714-01 0.1 mL

Rabbit anti-human complement factor H-related 3 polyclonal Antibody

Sign In for Pricing
View Details