Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse AMH protein

This Mouse AMH protein spans the amino acid sequence from region 450-552aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Muellerian hormone protein, MIS protein, Muellerian inhibiting factor protein, Mullerian inhibiting substance protein, AMH protein

UniProt

P27106

Expression Region

450-552aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1156 Rat siRNA Oligo Duplex (Locus ID 405171)
SR507330 1 Kit

Olr1156 Rat siRNA Oligo Duplex (Locus ID 405171)

Sign In for Pricing
View Details
ODN INH-1 (sodium)
HY-153841A 1 Each

ODN INH-1 (sodium)

Sign In for Pricing
View Details
Human NDUFB9 Protein Lysate 20ug
IHUNDUFB9PLLY20UG 20 µg

Human NDUFB9 Protein Lysate 20ug

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1204
BCBS-1204 1 Unit

Biological Safety Cabinet Class II BCBS-1204

Sign In for Pricing
View Details
GSTZ1 Antibody
orb1327719 100 µg

GSTZ1 Antibody

Sign In for Pricing
View Details
UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1, GNT1, HUG-BR1, UDPGT, UGT1, UGT1A) (MaxLight 490)
MBS6209254-01 0.1 mL

UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1, GNT1, HUG-BR1, UDPGT, UGT1, UGT1A) (MaxLight 490)

Sign In for Pricing
View Details