Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASAH2B protein

This Human ASAH2B protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASAH2B

UniProt

P0C7U1

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-165aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-02 0.02 mg (Yeast)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-04 0.1 mg (Yeast)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)
MBS1047485-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Uncharacterized sulfatase yidJ (yidJ)

Sign In for Pricing
View Details