Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aquaporin 4 Proteins

This Aquaporin 4 Proteins spans the amino acid sequence from region 253-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-AQP 4 antibody, anti-AQP-4 antibody, anti-AQP4 antibody, anti-Aquaporin type 4 antibody, anti-AQP4_HUMAN antibody, anti-Aquaporin-4 antibody, anti-Aquaporin4 antibody, anti-Aquaporin 4 antibody

UniProt

P55087

Expression Region

253-323aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic of His-SUMO-tag and expression region is 253-323aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS800832 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
XIAP Recombinant Rabbit Monoclonal Antibody [PSH04-30]
HA722113 100 µL

XIAP Recombinant Rabbit Monoclonal Antibody [PSH04-30]

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF640R conjugate, 0.1mg/mL
BNC402418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR6C65 Human Gene Knockout Kit (CRISPR)
KN415462 1 Kit

OR6C65 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Fgf15 activation kit by CRISPRa
GA201397 1 Kit

Mouse Fgf15 activation kit by CRISPRa

Sign In for Pricing
View Details
AtGLP7 Rabbit Polyclonal Antibody
ER2001-03 100 µL

AtGLP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details