Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGTR1 protein

This Human AGTR1 protein spans the amino acid sequence from region 297-359aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGTR1

UniProt

P30556

Expression Region

297-359aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNKD, NT (PNKD, KIAA1184, MR1, TAHCCP2, Probable hydrolase PNKD, Myofibrillogenesis regulator 1, Paroxysmal nonkinesiogenic dyskinesia protein, Trans-activated by hepatitis C virus core protein 2) (Azide free) (HRP) discontinued
040209-HRP 200 µL

PNKD, NT (PNKD, KIAA1184, MR1, TAHCCP2, Probable hydrolase PNKD, Myofibrillogenesis regulator 1, Paroxysmal nonkinesiogenic dyskinesia protein, Trans-activated by hepatitis C virus core protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
25-O-Methylalisol A
FGA80100-01 10 mg

25-O-Methylalisol A

Sign In for Pricing
View Details
25-O-Methylalisol A
FGA80100-02 25 mg

25-O-Methylalisol A

Sign In for Pricing
View Details
25-O-Methylalisol A
FGA80100-03 50 mg

25-O-Methylalisol A

Sign In for Pricing
View Details
Calcium molybdate
C01560 200 g

Calcium molybdate

Sign In for Pricing
View Details
SHOX, CT (Short stature homeobox protein, SHOX, PHOG) (MaxLight 550) discontinued
041719-ML550 100 µL

SHOX, CT (Short stature homeobox protein, SHOX, PHOG) (MaxLight 550) discontinued

Sign In for Pricing
View Details