Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AK1 protein

This Human AK1 protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AK1

UniProt

P00568

Expression Region

1-194aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-194aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tetranectin Antibody
RC-15888-01 50 μL

Recombinant Tetranectin Antibody

Sign In for Pricing
View Details
Recombinant Tetranectin Antibody
RC-15888-02 100 µL

Recombinant Tetranectin Antibody

Sign In for Pricing
View Details
Recombinant Tetranectin Antibody
RC-15888-03 1 mL

Recombinant Tetranectin Antibody

Sign In for Pricing
View Details
TGM1 Protein Lysate (Human) with C-Ha Tag
46610031 100 µg

TGM1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mouse α1-AGP (α1-Acid glycoprotein) ELISA Kit
orb2647849-01 48 Tests

Mouse α1-AGP (α1-Acid glycoprotein) ELISA Kit

Sign In for Pricing
View Details
Mouse α1-AGP (α1-Acid glycoprotein) ELISA Kit
orb2647849-02 96 Tests

Mouse α1-AGP (α1-Acid glycoprotein) ELISA Kit

Sign In for Pricing
View Details