Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AK1 protein

This Human AK1 protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AK1

UniProt

P00568

Expression Region

1-194aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-194aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATM Protein Kinase pS1981 for WB IF and IP, Antibody
GWB-494129 0.1 mg

Anti-ATM Protein Kinase pS1981 for WB IF and IP, Antibody

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human HMOX1 mAb
A27939-01 50 Tests

ABflo® 647 Rabbit anti-Human HMOX1 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human HMOX1 mAb
A27939-02 100 Tests

ABflo® 647 Rabbit anti-Human HMOX1 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human HMOX1 mAb
A27939-03 200 Tests

ABflo® 647 Rabbit anti-Human HMOX1 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human HMOX1 mAb
A27939-04 500 Tests

ABflo® 647 Rabbit anti-Human HMOX1 mAb

Sign In for Pricing
View Details
Recombinant Human ACSM5
MBS7617546-01 0.05 mg

Recombinant Human ACSM5

Sign In for Pricing
View Details