Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Aif1 protein

This Rat Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

P55009

Expression Region

2-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK beta (IKBKB) Human shRNA Plasmid Kit (Locus ID 3551)
TR320385 1 Kit

IKK beta (IKBKB) Human shRNA Plasmid Kit (Locus ID 3551)

Sign In for Pricing
View Details
ERAS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0690406 1.0 µg DNA

ERAS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ERN1 (Endoplasmic Reticulum to Nucleus Signaling 1, FLJ30999, IRE1, IRE1P, MGC163277, MGC163279) (HRP)
245828-HRP 100 µL

ERN1 (Endoplasmic Reticulum to Nucleus Signaling 1, FLJ30999, IRE1, IRE1P, MGC163277, MGC163279) (HRP)

Sign In for Pricing
View Details
5-Trifluoromethyl-pyridin-2-acetic acid sodium salt
GDD36639-01 1 g

5-Trifluoromethyl-pyridin-2-acetic acid sodium salt

Sign In for Pricing
View Details
5-Trifluoromethyl-pyridin-2-acetic acid sodium salt
GDD36639-02 10 g

5-Trifluoromethyl-pyridin-2-acetic acid sodium salt

Sign In for Pricing
View Details
Rabbit Monoclonal WDR5 Antibody (RAB-C223) [Alexa Fluor 405] - Chimeric
NBP3-20133AF405 0.1 mL

Rabbit Monoclonal WDR5 Antibody (RAB-C223) [Alexa Fluor 405] - Chimeric

Sign In for Pricing
View Details