Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Aif1 protein

This Rat Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

P55009

Expression Region

2-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZ3, CT (DAZ3, Deleted in azoospermia protein 3) (FITC)
MBS6290873-01 0.2 mL

DAZ3, CT (DAZ3, Deleted in azoospermia protein 3) (FITC)

Sign In for Pricing
View Details
DAZ3, CT (DAZ3, Deleted in azoospermia protein 3) (FITC)
MBS6290873-02 5x 0.2 mL

DAZ3, CT (DAZ3, Deleted in azoospermia protein 3) (FITC)

Sign In for Pricing
View Details
ATPase family AAA domain-containing protein 3C (ATAD3C) Human ELISA Kit
B7468 96 Tests

ATPase family AAA domain-containing protein 3C (ATAD3C) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CNTN2 protein (C-6His)
CD02020-01 10 µg

Recombinant Human CNTN2 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human CNTN2 protein (C-6His)
CD02020-02 50 µg

Recombinant Human CNTN2 protein (C-6His)

Sign In for Pricing
View Details
Cp (NM_001042611) Mouse Tagged ORF Clone Lentiviral Particle
MR222884L4V 200 µL

Cp (NM_001042611) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details