Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GMPR2 protein

This Human GMPR2 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GMPR2

UniProt

Q9P2T1

Expression Region

1-366aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WRAP53 3'UTR Luciferase Stable Cell Line
TU028528 1.0 mL

WRAP53 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GRM8 discontinued
389780-01 20 µL

GRM8 discontinued

Sign In for Pricing
View Details
GRM8 discontinued
389780-02 200 µL

GRM8 discontinued

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PFL5 Polyclonal Antibody
MBS9013398 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PFL5 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SPANXN1 shRNA (UAS) - Lentiviral human SPANXN1 shRNA (UAS, RFP) plasmid
GTR15307120 1 Vial

Lentiviral human SPANXN1 shRNA (UAS) - Lentiviral human SPANXN1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-NF-kappaB p105 Antibody
MBS8322112-01 0.03 mL

Anti-NF-kappaB p105 Antibody

Sign In for Pricing
View Details