Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli C12orf49 protein

This E.coli C12orf49 protein spans the amino acid sequence from region 34-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C12orf49

UniProt

Q9H741

Expression Region

34-205aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT1 Antibody
E30AOC505 100 µL

CNOT1 Antibody

Sign In for Pricing
View Details
Hydrophobic polishing resin
orb3137162-01 10 mg

Hydrophobic polishing resin

Sign In for Pricing
View Details
Hydrophobic polishing resin
orb3137162-02 50 mg

Hydrophobic polishing resin

Sign In for Pricing
View Details
Mouse Myrfl Pre-designed siRNA Set A
SI109020A 1 Each

Mouse Myrfl Pre-designed siRNA Set A

Sign In for Pricing
View Details
SCN9A Antibody, Biotin conjugated
CSB-PA613605LD01HU-01 50 µg

SCN9A Antibody, Biotin conjugated

Sign In for Pricing
View Details
SCN9A Antibody, Biotin conjugated
CSB-PA613605LD01HU-02 100 µg

SCN9A Antibody, Biotin conjugated

Sign In for Pricing
View Details