Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli C12orf49 protein

This E.coli C12orf49 protein spans the amino acid sequence from region 34-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C12orf49

UniProt

Q9H741

Expression Region

34-205aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R,2R) -2- (3,4-Difluorophenyl) cyclopropanecarboxylic acid ethyl ester
FD98897 0.25 g

(1R,2R) -2- (3,4-Difluorophenyl) cyclopropanecarboxylic acid ethyl ester

Sign In for Pricing
View Details
RPS7 (40S Ribosomal Protein S7) (AP) discontinued
132831-AP 100 µL

RPS7 (40S Ribosomal Protein S7) (AP) discontinued

Sign In for Pricing
View Details
CMAS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV678971 1.0 µg DNA

CMAS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ELOVL6 Polyclonal Antibody
RD89368A-01 60 μL

ELOVL6 Polyclonal Antibody

Sign In for Pricing
View Details
ELOVL6 Polyclonal Antibody
RD89368A-02 120 μL

ELOVL6 Polyclonal Antibody

Sign In for Pricing
View Details
ELOVL6 Polyclonal Antibody
RD89368A-03 200 µL

ELOVL6 Polyclonal Antibody

Sign In for Pricing
View Details