Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli dapA protein

This E. coli dapA protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DapA, b2478, JW2463

UniProt

P0A6L2

Expression Region

1-292aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: 16C4-2]
TA808710AM 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: 16C4-2]

Sign In for Pricing
View Details
Rabbit Polyclonal Glutathione S-Transferase pi 1/GSTP1 Antibody
NBP1-76857 0.1 mg

Rabbit Polyclonal Glutathione S-Transferase pi 1/GSTP1 Antibody

Sign In for Pricing
View Details
Recombinant PRRSV GP2 Protein, C-Fc
EVV34201 100 μg

Recombinant PRRSV GP2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Xenopus laevis ATPase family AAA domain-containing protein 3-B (atad3-b), partial
MBS7088220 Inquire

Recombinant Xenopus laevis ATPase family AAA domain-containing protein 3-B (atad3-b), partial

Sign In for Pricing
View Details
PCMV-CHEK2 (human) -3xFLAG-Neo
BZ58140 1 Vial

PCMV-CHEK2 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
BLOC1S5 Knockout AGS Polyclonal Cells
ARG26761 1 Million

BLOC1S5 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details