Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H2BN protein

This Human HIST1H2BN protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HIST1H2BN

UniProt

Q99877

Expression Region

2-126aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist1h1c (H1f2) (NM_015786) Mouse Tagged Lenti ORF Clone
MR219732L4 10 µg

Hist1h1c (H1f2) (NM_015786) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SESN3 rabbit pAb
UB-GEN-11722 100 µL

SESN3 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27b) [Janelia Fluor 635]
NB300-154JF635 0.2 mL

Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27b) [Janelia Fluor 635]

Sign In for Pricing
View Details
Fmoc-Phe-Arg-OH
B-1510.0005 5.0g

Fmoc-Phe-Arg-OH

Sign In for Pricing
View Details
Anti-SAV1 Antibody Picoband® Fluoro594 Conjugated
A04183-2-Fluoro594 100 µg/Vial

Anti-SAV1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Ugt2b37 (NM_001007264) Rat Tagged ORF Clone Lentiviral Particle
RR209491L4V 200 µL

Ugt2b37 (NM_001007264) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details