Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Pectate lyase 1 protein

This E.coli Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1

UniProt

Q96385

Expression Region

22-375aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chamaecyparis obtusa (Hinoki false-cypress)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490) discontinued
039185-ML490 100 µL

Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Camel Perforin ELISA Kit
MBS104140-01 48 Well

Camel Perforin ELISA Kit

Sign In for Pricing
View Details
Camel Perforin ELISA Kit
MBS104140-02 96 Well

Camel Perforin ELISA Kit

Sign In for Pricing
View Details
Camel Perforin ELISA Kit
MBS104140-03 5x 96 Well

Camel Perforin ELISA Kit

Sign In for Pricing
View Details
Camel Perforin ELISA Kit
MBS104140-04 10x 96 Well

Camel Perforin ELISA Kit

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to EGF Like Module Containing Mucin Like Hormone Receptor 2 (EMR2)
MBS2058659-01 0.1 mL

PE-Linked Polyclonal Antibody to EGF Like Module Containing Mucin Like Hormone Receptor 2 (EMR2)

Sign In for Pricing
View Details