Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Pectate lyase 1 protein

This E.coli Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1

UniProt

Q96385

Expression Region

22-375aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chamaecyparis obtusa (Hinoki false-cypress)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FGF16
Z102295 20 µg

Recombinant Human FGF16

Sign In for Pricing
View Details
RASGRP2 Polyclonal Antibody
E-AB-91139-01 60 µL

RASGRP2 Polyclonal Antibody

Sign In for Pricing
View Details
RASGRP2 Polyclonal Antibody
E-AB-91139-02 120 µL

RASGRP2 Polyclonal Antibody

Sign In for Pricing
View Details
RASGRP2 Polyclonal Antibody
E-AB-91139-03 200 µL

RASGRP2 Polyclonal Antibody

Sign In for Pricing
View Details
BCAP31 Antibody
orb1256629 100 µL

BCAP31 Antibody

Sign In for Pricing
View Details
RBM17 Rabbit Polyclonal Antibody (BF594)
orb2465894 100 µL

RBM17 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details