Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTN2A2 protein

This Human BTN2A2 protein spans the amino acid sequence from region 33-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTN2A2

UniProt

Q8WVV5

Expression Region

33-262aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPREB3 Rabbit Polyclonal Antibody
orb632533-01 50 µg

VPREB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPREB3 Rabbit Polyclonal Antibody
orb632533-02 100 µg

VPREB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human IL6 (OPR-003)
PTX26061 100 µg

Anti-Human IL6 (OPR-003)

Sign In for Pricing
View Details
Eldecalcitol Impurity 21
RM-E120421-01 10 mg

Eldecalcitol Impurity 21

Sign In for Pricing
View Details
Eldecalcitol Impurity 21
RM-E120421-02 25 mg

Eldecalcitol Impurity 21

Sign In for Pricing
View Details
Eldecalcitol Impurity 21
RM-E120421-03 50 mg

Eldecalcitol Impurity 21

Sign In for Pricing
View Details