Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il18bp protein

This Mouse Il18bp protein spans the amino acid sequence from region 29-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il18bp

UniProt

Q9Z0M9

Expression Region

29-193aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MTUS1 Polyclonal Antibody
HV495014-01 50 µg

Anti-MTUS1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MTUS1 Polyclonal Antibody
HV495014-02 100 µg

Anti-MTUS1 Polyclonal Antibody

Sign In for Pricing
View Details
EEC1 Recombinant Protein (Human)
RP056052 100 µg

EEC1 Recombinant Protein (Human)

Sign In for Pricing
View Details
TRAPPC2P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV787618 1.0 µg DNA

TRAPPC2P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PRC1 Protein Vector (Mouse) (pPB-N-His)
PV218963 500 ng

PRC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Poly (D, L-lactide-co-glycolide)
TCL-01060-01 10 mg

Poly (D, L-lactide-co-glycolide)

Sign In for Pricing
View Details