Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat TIMP1 protein

This Rat TIMP1 protein spans the amino acid sequence from region 24-217aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Clgi protein, Collagenase inhibitor protein, Collagenase inhibitor, Human protein, EPA protein, Erythroid Potentiating Activity protein, Erythroid-potentiating activity protein, Fibroblast collagenase inhibitor protein, HCI protein, Human Collagenase Inhibitor protein, Metalloproteinase inhibitor 1 protein, Metalloproteinase inhibitor 1 precursor protein, TIMP 1 protein, TIMP protein, TIMP metallopeptidase inhibitor 1 protein, TIMP-1 protein, Timp1 protein, TIMP1 protein protein, Tissue Inhibitor of Metalloproteinase 1 protein, Tissue inhibitor of metalloproteinases 1 protein, Tissue inhibitor of metalloproteinases protein

UniProt

P30120

Expression Region

24-217aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Irdabisant
BA5424-10 10 mg

Irdabisant

Sign In for Pricing
View Details
ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (AP)
MBS6129858-01 0.1 mL

ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (AP)

Sign In for Pricing
View Details
ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (AP)
MBS6129858-02 5x 0.1 mL

ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (AP)

Sign In for Pricing
View Details
Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit
MBS9941902-01 48 Well

Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit

Sign In for Pricing
View Details
Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit
MBS9941902-02 96 Well

Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit

Sign In for Pricing
View Details
Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit
MBS9941902-03 5x 96 Well

Bovine GTP-Binding Protein Di-Ras3 (DIRAS3) ELISA Kit

Sign In for Pricing
View Details