Rat TIMP1 protein

Clgi protein, Collagenase inhibitor protein, Collagenase inhibitor, Human protein, EPA protein, Erythroid Potentiating Activity protein, Erythroid-potentiating activity protein, Fibroblast collagenase inhibitor protein, HCI protein, Human Collagenase Inhibitor protein, Metalloproteinase inhibitor 1 protein, Metalloproteinase inhibitor 1 precursor protein, TIMP 1 protein, TIMP protein, TIMP metallopeptidase inhibitor 1 protein, TIMP-1 protein, Timp1 protein, TIMP1 protein protein, Tissue Inhibitor of Metalloproteinase 1 protein, Tissue inhibitor of metalloproteinases 1 protein, Tissue inhibitor of metalloproteinases protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA