Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat eNOS protein

This Rat eNOS protein spans the amino acid sequence from region 519-690aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNOS protein, Constitutive NOS protein, EC NOS protein, EC-NOS protein, ecNOS protein, Endothelial nitric oxidase synthase protein, Endothelial nitric oxide synthase protein, Endothelial nitric oxide synthase 3 protein, Endothelial NOS protein, eNOS protein, Nitric oxide synthase 3 (endothelial cell) protein, Nitric oxide synthase 3 protein, Nitric oxide synthase 3 endothelial cell protein, Nitric oxide synthase endothelial protein, Nitric oxide synthase, endothelial protein, NOS 3 protein, NOS III protein, NOS type III protein, NOS3 protein, NOS3_HUMAN protein, NOSIII protein

UniProt

Q62600

Expression Region

519-690aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADD 45γ Lentiviral Activation Particles (m)
sc-423879-LAC 200 µL

GADD 45γ Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Anti-DNA Ligase 1 Antibody
CPA7201-01 30 µL

Anti-DNA Ligase 1 Antibody

Sign In for Pricing
View Details
Anti-DNA Ligase 1 Antibody
CPA7201-02 50 μL

Anti-DNA Ligase 1 Antibody

Sign In for Pricing
View Details
Anti-DNA Ligase 1 Antibody
CPA7201-03 100 µL

Anti-DNA Ligase 1 Antibody

Sign In for Pricing
View Details
Anti-DNA Ligase 1 Antibody
CPA7201-04 200 µL

Anti-DNA Ligase 1 Antibody

Sign In for Pricing
View Details
FAUP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV761340 1.0 µg DNA

FAUP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details