Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhi Outer membrane protein A (ompA)

This Recombinant Salmonella typhi Outer membrane protein A (ompA) spans the amino acid sequence from region 27-349aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpA STY1091 t1850 A

UniProt

Q8Z7S0

Expression Region

27-349aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TWYAGAKLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUBP3 (Far Upstream Element (FUSE) Binding Protein 3, FBP3) (MaxLight 750)
MBS6238359-01 0.1 mL

FUBP3 (Far Upstream Element (FUSE) Binding Protein 3, FBP3) (MaxLight 750)

Sign In for Pricing
View Details
FUBP3 (Far Upstream Element (FUSE) Binding Protein 3, FBP3) (MaxLight 750)
MBS6238359-02 5x 0.1 mL

FUBP3 (Far Upstream Element (FUSE) Binding Protein 3, FBP3) (MaxLight 750)

Sign In for Pricing
View Details
Cat Procollagen C Proteinase Enhancer 1 ELISA Kit
MBS096248 Inquire

Cat Procollagen C Proteinase Enhancer 1 ELISA Kit

Sign In for Pricing
View Details
GPRIN3 3'UTR GFP Stable Cell Line
TU059264 1.0 mL

GPRIN3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Benzyl 2- (hydrazinecarbonyl) morpholine-4-carboxylate
JFC42909-01 50 mg

Benzyl 2- (hydrazinecarbonyl) morpholine-4-carboxylate

Sign In for Pricing
View Details
Benzyl 2- (hydrazinecarbonyl) morpholine-4-carboxylate
JFC42909-02 0.5 g

Benzyl 2- (hydrazinecarbonyl) morpholine-4-carboxylate

Sign In for Pricing
View Details