Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Avpr1a protein

This Rat Avpr1a protein spans the amino acid sequence from region 7-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Avpr1a

UniProt

P30560

Expression Region

7-52aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dog Albumin (ALB), Biotinylated
orb3053913-01 20 µg

Recombinant Dog Albumin (ALB), Biotinylated

Sign In for Pricing
View Details
Recombinant Dog Albumin (ALB), Biotinylated
orb3053913-02 100 µg

Recombinant Dog Albumin (ALB), Biotinylated

Sign In for Pricing
View Details
Recombinant Dog Albumin (ALB), Biotinylated
orb3053913-03 1 mg

Recombinant Dog Albumin (ALB), Biotinylated

Sign In for Pricing
View Details
Gigaxonin Lentiviral Activation Particles (m2)
sc-431626-LAC-2 200 µL

Gigaxonin Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Cadherin 2 Antibody / CDH2 / N-Cadherin
V5631-20UG 20 µg

Cadherin 2 Antibody / CDH2 / N-Cadherin

Sign In for Pricing
View Details
WHSC1 (NM_133334) Human Untagged Clone
SC309582 10 µg

WHSC1 (NM_133334) Human Untagged Clone

Sign In for Pricing
View Details