Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Avpr1a protein

This Rat Avpr1a protein spans the amino acid sequence from region 7-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Avpr1a

UniProt

P30560

Expression Region

7-52aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LSM11 sgRNA gene knockout kit - Lentiviral human LSM11 sgRNA gene knockout kit (plasmid)
GTR15395552 1 Vial

Lentiviral human LSM11 sgRNA gene knockout kit - Lentiviral human LSM11 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid
OR82818-01 100 mg

2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid

Sign In for Pricing
View Details
2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid
OR82818-02 1 g

2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid

Sign In for Pricing
View Details
2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid
OR82818-03 5 g

2- (3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl) acetic acid

Sign In for Pricing
View Details
NPRL3 Antibody, HRP conjugated
CSB-PA619643LB01HU-01 50 µg

NPRL3 Antibody, HRP conjugated

Sign In for Pricing
View Details
NPRL3 Antibody, HRP conjugated
CSB-PA619643LB01HU-02 100 µg

NPRL3 Antibody, HRP conjugated

Sign In for Pricing
View Details