Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Avpr1a protein

This Rat Avpr1a protein spans the amino acid sequence from region 7-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Avpr1a

UniProt

P30560

Expression Region

7-52aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGES Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV729355 1.0 µg DNA

IGES Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
MOBP (m) -PR
sc-35954-PR 10 µM - 20 µL

MOBP (m) -PR

Sign In for Pricing
View Details
5 Lipoxygenase Rabbit monoclonal antibody
BS40737 50ul

5 Lipoxygenase Rabbit monoclonal antibody

Sign In for Pricing
View Details
EIF2S2 Antibody - N-terminal region : FITC (ARP40502_P050-FITC)
ARP40502_P050-FITC 100 µL

EIF2S2 Antibody - N-terminal region : FITC (ARP40502_P050-FITC)

Sign In for Pricing
View Details
Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)
orb2923225-01 20 µg

Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)

Sign In for Pricing
View Details
Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)
orb2923225-02 100 µg

Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)

Sign In for Pricing
View Details