Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OXNAD1 protein

This Human OXNAD1 protein spans the amino acid sequence from region 18-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OXNAD1

UniProt

Q96HP4

Expression Region

18-312aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF-562271 besylate
orb1301007-01 1 mg

PF-562271 besylate

Sign In for Pricing
View Details
PF-562271 besylate
orb1301007-02 5 mg

PF-562271 besylate

Sign In for Pricing
View Details
PF-562271 besylate
orb1301007-03 10 mg

PF-562271 besylate

Sign In for Pricing
View Details
PF-562271 besylate
orb1301007-04 1 ml x 10 mM (in DMSO)

PF-562271 besylate

Sign In for Pricing
View Details
PF-562271 besylate
orb1301007-05 25 mg

PF-562271 besylate

Sign In for Pricing
View Details
PF-562271 besylate
orb1301007-06 50 mg

PF-562271 besylate

Sign In for Pricing
View Details