Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Nsf Erg1 protein

This Rat Nsf Erg1 protein spans the amino acid sequence from region 7-209aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nsf Erg1

UniProt

Q9QUL6

Expression Region

7-209aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN7 Antibody
OC-1569-01 50 μL

CAPN7 Antibody

Sign In for Pricing
View Details
CAPN7 Antibody
OC-1569-02 100 µL

CAPN7 Antibody

Sign In for Pricing
View Details
CAPN7 Antibody
OC-1569-03 1 mL

CAPN7 Antibody

Sign In for Pricing
View Details
OR13A1 (NM_001004297) Human Over-expression Lysate
LC424075 20 µg

OR13A1 (NM_001004297) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2Z Polyclonal Antibody
E-AB-18434-01 20 µL

UBE2Z Polyclonal Antibody

Sign In for Pricing
View Details
UBE2Z Polyclonal Antibody
E-AB-18434-02 60 µL

UBE2Z Polyclonal Antibody

Sign In for Pricing
View Details