Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli tetX protein

This E.coli tetX protein spans the amino acid sequence from region 2-457aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TetX

UniProt

P04958

Expression Region

2-457aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Clostridium tetani (strain Massachusetts / E88)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOS (NM_005372) Human Over-expression Lysate
LS004342-20ug 20 µg

MOS (NM_005372) Human Over-expression Lysate

Sign In for Pricing
View Details
FRA10B Protein Vector (Human) (pPM-C-HA)
PV078887 500 ng

FRA10B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human KRT5 Protein Lysate
MBS8414231-01 0.02 mg

Human KRT5 Protein Lysate

Sign In for Pricing
View Details
Human KRT5 Protein Lysate
MBS8414231-02 5x 0.02 mg

Human KRT5 Protein Lysate

Sign In for Pricing
View Details
1,9-Bis (4-fluorophenyl) nonane-1,5,9-trione
411516 1 mg

1,9-Bis (4-fluorophenyl) nonane-1,5,9-trione

Sign In for Pricing
View Details
Atorvastatin epoxydione impurity
259722-01 5 mg

Atorvastatin epoxydione impurity

Sign In for Pricing
View Details