Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Pectate lyase 5 protein

This E.coli Pectate lyase 5 protein spans the amino acid sequence from region 26-396aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pectate lyase 5, EC 4.2.2.2, Antigen Amb a I, Antigen E, AgE, Pollen allergen Amb a 1.1, allergen Amb a 1.1

UniProt

P27759

Expression Region

26-396aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Ambrosia artemisiifolia (Short ragweed)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 26-396aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCP4 Polyclonal Antibody
MBS9234028-01 0.1 mL

PCP4 Polyclonal Antibody

Sign In for Pricing
View Details
PCP4 Polyclonal Antibody
MBS9234028-02 5x 0.1 mL

PCP4 Polyclonal Antibody

Sign In for Pricing
View Details
STAP1, NT (F56) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)
MBS623452-01 0.2 mL

STAP1, NT (F56) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)

Sign In for Pricing
View Details
STAP1, NT (F56) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)
MBS623452-02 5x 0.2 mL

STAP1, NT (F56) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)

Sign In for Pricing
View Details
LKB1, phosphorylated (Ser428)
378531 200 µL

LKB1, phosphorylated (Ser428)

Sign In for Pricing
View Details
PAGE3 Antibody
MBS8582342-01 0.1 mL

PAGE3 Antibody

Sign In for Pricing
View Details