Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli VP4 protein

This E.coli VP4 protein spans the amino acid sequence from region 247-479aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer capsid protein VP4, Hemagglutinin) [Cleaved into, Outer capsid protein VP8*, Outer capsid protein VP5*]

UniProt

P11200

Expression Region

247-479aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rotavirus A (strain Human/United Kingdom/ST3/1975 G4-P2A[6]-I1-R1-C1-M1-A1-N1-T1-E1-H1) (RV-A) (Rotavirus A (strain St. Thomas 3) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Antigen domain of His-SUMO-tag and expression region is 247-479aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OSMR Protein, C-Fc
orb3149320-01 50 µg

Recombinant Human OSMR Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human OSMR Protein, C-Fc
orb3149320-02 100 µg

Recombinant Human OSMR Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human OSMR Protein, C-Fc
orb3149320-03 1 mg

Recombinant Human OSMR Protein, C-Fc

Sign In for Pricing
View Details
Guinea pig Teneurin-2 (ODZ2) ELISA Kit
MBS7233783-01 48 Well

Guinea pig Teneurin-2 (ODZ2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Teneurin-2 (ODZ2) ELISA Kit
MBS7233783-02 96 Well

Guinea pig Teneurin-2 (ODZ2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Teneurin-2 (ODZ2) ELISA Kit
MBS7233783-03 5x 96 Well

Guinea pig Teneurin-2 (ODZ2) ELISA Kit

Sign In for Pricing
View Details