Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli stxB protein

This E.coli stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-89aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin β3 (phospho-Tyr785)
orb1139969 100 µg

Anti-Integrin β3 (phospho-Tyr785)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) CMOB Polyclonal Antibody
MBS7171207 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) CMOB Polyclonal Antibody

Sign In for Pricing
View Details
DDX46 (B-6) HRP
sc-514071 HRP 200 µg/mL

DDX46 (B-6) HRP

Sign In for Pricing
View Details
M/M044/NL410/RFL-390X590-1 Marine & IMO Signs & Labels (Adhesive)
303267 1 Pack (1 Panel (s) x 1 Pack)

M/M044/NL410/RFL-390X590-1 Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details
VHL CRISPR Activation Plasmid (m2)
sc-423671-ACT-2 20 µg

VHL CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Anti-Mouse 4-1BB (3H3) In Vivo Antibody - Low Endotoxin
ICH1036-25mg 25 mg

Anti-Mouse 4-1BB (3H3) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details