Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli SPN protein

This E.coli SPN protein spans the amino acid sequence from region 20-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SPN

UniProt

P16150

Expression Region

20-253aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 20-253aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFML2A Lentiviral Activation Particles (h)
sc-414915-LAC 200 µL

OLFML2A Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Anti-ERG/KCNH2 Polyclonal Antibody 2
TMAB-05665-01 50 μL

Anti-ERG/KCNH2 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-ERG/KCNH2 Polyclonal Antibody 2
TMAB-05665-02 100 µL

Anti-ERG/KCNH2 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-ERG/KCNH2 Polyclonal Antibody 2
TMAB-05665-03 200 µL

Anti-ERG/KCNH2 Polyclonal Antibody 2

Sign In for Pricing
View Details
SH2 domain-containing 3C.
FP-0076 Each

SH2 domain-containing 3C.

Sign In for Pricing
View Details
Rat Interleukin 5 ELISA kit
GTR10469124 96 Well

Rat Interleukin 5 ELISA kit

Sign In for Pricing
View Details