Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli SPN protein

This E.coli SPN protein spans the amino acid sequence from region 20-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SPN

UniProt

P16150

Expression Region

20-253aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 20-253aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA (aa 18-343) (A/Brisbane/02/2018) (H1N1)-pdm09-like
MBS430512-01 0.05 mg

HA (aa 18-343) (A/Brisbane/02/2018) (H1N1)-pdm09-like

Sign In for Pricing
View Details
HA (aa 18-343) (A/Brisbane/02/2018) (H1N1)-pdm09-like
MBS430512-02 5x 0.05 mg

HA (aa 18-343) (A/Brisbane/02/2018) (H1N1)-pdm09-like

Sign In for Pricing
View Details
SNORD116-27 AAV Vector (Human) (CMV)
44798101 1 µg

SNORD116-27 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Elongation factor G (fusA), partial
MBS1326308 Inquire

Recombinant Moorella thermoacetica Elongation factor G (fusA), partial

Sign In for Pricing
View Details
HMGA1 Recombinant Protein (Mouse)
RP141830 100 µg

HMGA1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Protein-serine O-palmitoleoyltransferase porcupine
orb1638194-01 50 µg

Protein-serine O-palmitoleoyltransferase porcupine

Sign In for Pricing
View Details