Human CD41 protein

Antigen CD41 protein, CD 41 protein, CD41 protein, CD-41 protein, CD41 antigen protein, CD41a protein, CD41b protein, GP2b protein, GPalpha IIb protein, GPalphaIIb protein, GPIIb protein, GT protein, Gta protein, HPA 3 protein, HPA3 protein, Integrin alpha 2b protein, Integrin alpha IIb protein, Integrin alpha IIb precursor protein, Integrin alpha-IIb light chain protein, ITGA 2B protein, ITGA2B protein, ITGAB protein, Platelet membrane glycoprotein IIb protein, Platelet specific antigen bak protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR