Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H2BB protein

This Human HIST1H2BB protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HIST1H2BB

UniProt

P33778

Expression Region

2-126aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-126aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A11 Protein, Human, Recombinant
MBS8120696-01 0.05 mg

S100A11 Protein, Human, Recombinant

Sign In for Pricing
View Details
S100A11 Protein, Human, Recombinant
MBS8120696-02 5x 0.05 mg

S100A11 Protein, Human, Recombinant

Sign In for Pricing
View Details
NBPF20 Recombinant Protein (Human)
RP077823 100 µg

NBPF20 Recombinant Protein (Human)

Sign In for Pricing
View Details
RPL13AP23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV776617 1.0 µg DNA

RPL13AP23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) thiourea
XZB90510-01 250 mg

(4-Chloro-3-fluorophenyl) thiourea

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) thiourea
XZB90510-02 2.5 g

(4-Chloro-3-fluorophenyl) thiourea

Sign In for Pricing
View Details