Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli FIBP protein

This E.coli FIBP protein spans the amino acid sequence from region 2-357aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIBP

UniProt

O43427

Expression Region

2-357aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform Short of His-SUMO-tag and expression region is 2-357aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL
BNC040416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-01 20 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-02 60 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-03 120 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-04 200 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat CD150/SLAM Protein (His Tag)
PKSR030210 100 µg

Recombinant Rat CD150/SLAM Protein (His Tag)

Sign In for Pricing
View Details