Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli DNM1 protein

Recombinant huamn Dynamin-1

Product Specifications

Product Name Alternative

DNM1

UniProt

Q05193

Expression Region

2-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 2-245aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human S1P3/EDG-3 Protein - (Dry Ice)
H00001903-Q01-10ug 10 µg

Recombinant Human S1P3/EDG-3 Protein - (Dry Ice)

Sign In for Pricing
View Details
TYRO3 Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA500414 100 µL

TYRO3 Mouse Monoclonal Antibody [Clone ID: OTI2C4]

Sign In for Pricing
View Details
Recombinant Canine C-X-C Motif Chemokine 16 (CXCL16), C-His
AP2C48 50 µg

Recombinant Canine C-X-C Motif Chemokine 16 (CXCL16), C-His

Sign In for Pricing
View Details
USP20 Human Over-expression Lysate
orb1342530 100 µg

USP20 Human Over-expression Lysate

Sign In for Pricing
View Details
RGD1562064 3'UTR Luciferase Stable Cell Line
TU218512 1.0 mL

RGD1562064 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Ribonuclease Y (rny), partial
MBS1110711 Inquire

Recombinant Staphylococcus aureus Ribonuclease Y (rny), partial

Sign In for Pricing
View Details