Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli DNM1 protein

Recombinant huamn Dynamin-1

Product Specifications

Product Name Alternative

DNM1

UniProt

Q05193

Expression Region

2-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 2-245aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinase-interacting Protein 2, NT (KIP 2, KIP2, Calcium and Integrin Binding Family Member 2, CIB2) (Azide free) (HRP) discontinued
K1775-75N-HRP 200 µL

Kinase-interacting Protein 2, NT (KIP 2, KIP2, Calcium and Integrin Binding Family Member 2, CIB2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
SH-PTP2 (Phospho-Tyr542) Polyclonal Polyclonal Conjugated Antibody
orb1630407 100 µL

SH-PTP2 (Phospho-Tyr542) Polyclonal Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AEBP1 pAb
PA10024-01 50 μL

Rabbit Anti-Human AEBP1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human AEBP1 pAb
PA10024-02 100 μL

Rabbit Anti-Human AEBP1 pAb

Sign In for Pricing
View Details
DCAF12 (NM_015397) Human Tagged ORF Clone
RG209423 10 µg

DCAF12 (NM_015397) Human Tagged ORF Clone

Sign In for Pricing
View Details
ColorTag pipette marking rings, for all Eppendorf 12- or 24-channel pipette lower parts and Move It adjustable tip spacing pipettes, neon yellow, inner diameter: 73 mm, 5 pcs.
4031-6662 5 Pieces

ColorTag pipette marking rings, for all Eppendorf 12- or 24-channel pipette lower parts and Move It adjustable tip spacing pipettes, neon yellow, inner diameter: 73 mm, 5 pcs.

Sign In for Pricing
View Details