Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli DNM1 protein

Recombinant huamn Dynamin-1

Product Specifications

Product Name Alternative

DNM1

UniProt

Q05193

Expression Region

2-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 2-245aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA (Proliferating Cell Nuclear antigen, MGC8367) (MaxLight 550)
249881-ML550 100 µL

PCNA (Proliferating Cell Nuclear antigen, MGC8367) (MaxLight 550)

Sign In for Pricing
View Details
HSP70 Antibody
PHY3420S 150 μg

HSP70 Antibody

Sign In for Pricing
View Details
2-Bromo-3-ethoxy-6-fluorophenylboronic acid
415756-01 25 mg

2-Bromo-3-ethoxy-6-fluorophenylboronic acid

Sign In for Pricing
View Details
2-Bromo-3-ethoxy-6-fluorophenylboronic acid
415756-02 50 mg

2-Bromo-3-ethoxy-6-fluorophenylboronic acid

Sign In for Pricing
View Details
ERN1 Protein Vector (Rat) (pPM-C-His)
PV266565 500 ng

ERN1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NAT10 Rabbit mAb
MBS8602086-01 0.1 mL

NAT10 Rabbit mAb

Sign In for Pricing
View Details