Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli DNM1 protein

Recombinant huamn Dynamin-1

Product Specifications

Product Name Alternative

DNM1

UniProt

Q05193

Expression Region

2-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 2-245aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TOM1 Pre-designed siRNA Set A
SI017147A 1 Each

Human TOM1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RSPO2 Over-expression Lysate Product
GWB-7A0CCA 0.1 mg

RSPO2 Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae ureG Protein (aa 1-205) (strain ATCC 700721 / MGH 78578)
VAng-Cr5530-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae ureG Protein (aa 1-205) (strain ATCC 700721 / MGH 78578)

Sign In for Pricing
View Details
TIMM22 Human siRNA Oligo Duplex (Locus ID 29928)
SR323940 1 Kit

TIMM22 Human siRNA Oligo Duplex (Locus ID 29928)

Sign In for Pricing
View Details
Noggin/NOG Protein, Mouse, Recombinant (His)
TMPJ-01065-01 5 µg

Noggin/NOG Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
Noggin/NOG Protein, Mouse, Recombinant (His)
TMPJ-01065-02 10 µg

Noggin/NOG Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details