Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNTNAP1 protein

This Human CNTNAP1 protein spans the amino acid sequence from region 26-356aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNTNAP1

UniProt

P78357

Expression Region

26-356aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 26-356aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGD5 Rabbit Polyclonal Antibody
TA359023 100 µL

TIGD5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ASAH3L (ACER2) activation kit by CRISPRa
GA117482 1 Kit

Human ASAH3L (ACER2) activation kit by CRISPRa

Sign In for Pricing
View Details
Pef1 (NM_026441) Mouse Recombinant Protein
E45M47680M5 20 µg

Pef1 (NM_026441) Mouse Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-01 20 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-02 100 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-03 2x 100 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details