Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNTNAP1 protein

This Human CNTNAP1 protein spans the amino acid sequence from region 26-356aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNTNAP1

UniProt

P78357

Expression Region

26-356aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 26-356aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APH1A Peptide
orb1234431 0.1 mg

APH1A Peptide

Sign In for Pricing
View Details
Human LGALS1 Matched Antibody Pair Set [ABP-S-02528]
ABP-S-02528 5 Plates

Human LGALS1 Matched Antibody Pair Set [ABP-S-02528]

Sign In for Pricing
View Details
GCDFP15 Polyclonal Antibody, FITC Conjugated
bs-4726R-FITC 100 µL

GCDFP15 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
DSP-0565 10mg
A18753-10 10 mg

DSP-0565 10mg

Sign In for Pricing
View Details
CDC2L5 (CDK13) Rabbit Polyclonal Antibody
TA362178 100 µL

CDC2L5 (CDK13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LSM11 Mouse Monoclonal Antibody [Clone 2G7]
E45M19356V-2 50 µL

LSM11 Mouse Monoclonal Antibody [Clone 2G7]

Sign In for Pricing
View Details