Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Batf3 protein

This Rat Batf3 protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Batf3

UniProt

P97876

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-133aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-human Proliferating Cell Nuclear Antigen (PCNA) IgG, aff pure
PCNA11-M 100 µL

Monoclonal Anti-human Proliferating Cell Nuclear Antigen (PCNA) IgG, aff pure

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus DNA repair protein recO (recO)
MBS1340891-01 0.02 mg (E-Coli)

Recombinant Myxococcus xanthus DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus DNA repair protein recO (recO)
MBS1340891-02 0.1 mg (E-Coli)

Recombinant Myxococcus xanthus DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus DNA repair protein recO (recO)
MBS1340891-03 0.02 mg (Yeast)

Recombinant Myxococcus xanthus DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus DNA repair protein recO (recO)
MBS1340891-04 0.1 mg (Yeast)

Recombinant Myxococcus xanthus DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus DNA repair protein recO (recO)
MBS1340891-05 0.02 mg (Baculovirus)

Recombinant Myxococcus xanthus DNA repair protein recO (recO)

Sign In for Pricing
View Details