Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Batf3 protein

This Rat Batf3 protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Batf3

UniProt

P97876

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-133aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Proteolipid Protein, CT (MPLP) (AP)
MBS6241847-01 0.1 mL

Myelin Proteolipid Protein, CT (MPLP) (AP)

Sign In for Pricing
View Details
Myelin Proteolipid Protein, CT (MPLP) (AP)
MBS6241847-02 5x 0.1 mL

Myelin Proteolipid Protein, CT (MPLP) (AP)

Sign In for Pricing
View Details
CDKN2B / p15 INK4b Rabbit pAb, IRDye 800CW conjugated
orb2870938 100 µL

CDKN2B / p15 INK4b Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Alkaline Phosphatase, Placental (ALPP) Monkey ELISA Kit
F9295 96 Tests

Alkaline Phosphatase, Placental (ALPP) Monkey ELISA Kit

Sign In for Pricing
View Details
CHUK, NT (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (AP)
MBS6286063-01 0.2 mL

CHUK, NT (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (AP)

Sign In for Pricing
View Details
CHUK, NT (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (AP)
MBS6286063-02 5x 0.2 mL

CHUK, NT (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (AP)

Sign In for Pricing
View Details