Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACAA1 protein

This Human ACAA1 protein spans the amino acid sequence from region 27-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACAA1

UniProt

P09110

Expression Region

27-331aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-tag and expression region is 27-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metastasis Associated 1 Family Member 2 (MTA2) Rabbit anti-Human Polyclonal (aa52-8) Antibody
GWB-AC2D4A 0.05 mg

Metastasis Associated 1 Family Member 2 (MTA2) Rabbit anti-Human Polyclonal (aa52-8) Antibody

Sign In for Pricing
View Details
PDK2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV675197 1.0 µg DNA

PDK2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody
MBS179928-01 0.03 mL

Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody
MBS179928-02 0.1 mL

Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody
MBS179928-03 5x 0.1 mL

Anti-CDC34/Ubch3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
3-O-Benzyl 17β-Estradiol-d3 17-Acetate
003516 5 mg

3-O-Benzyl 17β-Estradiol-d3 17-Acetate

Sign In for Pricing
View Details