Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACAA1 protein

This Human ACAA1 protein spans the amino acid sequence from region 27-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACAA1

UniProt

P09110

Expression Region

27-331aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-tag and expression region is 27-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7649-5p miRNA Inhibitor
MIM03091 2x 5.0 nmol

mmu-miR-7649-5p miRNA Inhibitor

Sign In for Pricing
View Details
Porcine ATP binding cassette sub family D member 3 (ABCD3) ELISA Kit
GTR10320361 96 Well

Porcine ATP binding cassette sub family D member 3 (ABCD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Glut1 Antibody (GLUT1/2476) - Azide and BSA Free
NBP2-75787 100 µg

Mouse Monoclonal Glut1 Antibody (GLUT1/2476) - Azide and BSA Free

Sign In for Pricing
View Details
Anti-Perforin/PRF1 Antibody Picoband® (Dylight594 Conjugate)
PB9155-Dylight594 100 µg

Anti-Perforin/PRF1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Human Olfactory receptor 52E8 (OR52E8) ELISA kit
GTR10452783 96 Well

Human Olfactory receptor 52E8 (OR52E8) ELISA kit

Sign In for Pricing
View Details
Necab1 (NM_178617) Mouse Untagged Clone
MC207682 10 µg

Necab1 (NM_178617) Mouse Untagged Clone

Sign In for Pricing
View Details